USP52 Antibody (6A7) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related USP52 Primary Antibodies

Order Details


    • Catalog Number
      H00009924-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP52 Antibody (6A7) [PerCP] Summary

Immunogen
USP52 (NP_055686, 1099 a.a. ~ 1199 a.a) partial recombinant protein with GST tag.TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTAL QLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEG QTSPKNAAVFSSVLAL
Localization
Cytoplasmic and Nuclear. Note=Shuttles between nucleus and cytoplasm.
Specificity
USP52 - ubiquitin specific peptidase 52
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP52 Antibody (6A7) [PerCP]

  • EC 3.1.13.4
  • FLJ39360
  • hPan2
  • Inactive ubiquitin carboxyl-terminal hydrolase 52
  • KIAA0710PAB-dependent poly(A)-specific ribonuclease subunit 2
  • NALP4
  • PABP-dependent poly(A) nuclease 2
  • PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • PAN2 polyA specific ribonuclease subunit
  • PYPAF4
  • ubiquitin specific peptidase 52
  • ubiquitin specific protease 52
  • USP52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-44286
Species: Hu
Applications: WB, IP
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF6116
Species: Hu
Applications: WB, ICC
MAB829
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for USP52 Antibody (H00009924-M01PCP) (0)

There are no publications for USP52 Antibody (H00009924-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP52 Antibody (H00009924-M01PCP) (0)

There are no reviews for USP52 Antibody (H00009924-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP52 Antibody (H00009924-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP52 Products

Bioinformatics Tool for USP52 Antibody (H00009924-M01PCP)

Discover related pathways, diseases and genes to USP52 Antibody (H00009924-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP52 Antibody (H00009924-M01PCP)

Discover more about diseases related to USP52 Antibody (H00009924-M01PCP).
 

Pathways for USP52 Antibody (H00009924-M01PCP)

View related products by pathway.

Blogs on USP52

There are no specific blogs for USP52, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP52 Antibody (6A7) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PAN2