USP48 Antibody

Images

 
Western Blot: USP48 Antibody [NBP1-59766] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related USP48 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59766
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP48 Antibody Summary

Immunogen
Synthetic peptides corresponding to USP48(ubiquitin specific peptidase 48) The peptide sequence was selected from the C terminal of USP48. Peptide sequence PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS.
Clonality
Polyclonal
Host
Rabbit
Gene
USP48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against USP48 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USP48 Antibody

  • Deubiquitinating enzyme 48
  • DKFZp762M1713
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ11328
  • FLJ20103
  • FLJ23054
  • FLJ23277
  • MGC132556
  • MGC14879
  • RAP1GA1
  • synUSP
  • ubiquitin carboxyl-terminal hydrolase 48
  • ubiquitin specific peptidase 48
  • ubiquitin specific protease 31
  • ubiquitin specific protease 48
  • ubiquitin thioesterase 48
  • Ubiquitin thiolesterase 48
  • Ubiquitin-specific-processing protease 48
  • USP31
  • USP48

Background

USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
640-A3
Species: Mu
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-32791
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001847-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
E-578
Species: Hu
BC100-494
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC

Publications for USP48 Antibody (NBP1-59766) (0)

There are no publications for USP48 Antibody (NBP1-59766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP48 Antibody (NBP1-59766) (0)

There are no reviews for USP48 Antibody (NBP1-59766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP48 Antibody (NBP1-59766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP48 Products

Bioinformatics Tool for USP48 Antibody (NBP1-59766)

Discover related pathways, diseases and genes to USP48 Antibody (NBP1-59766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP48 Antibody (NBP1-59766)

Discover more about diseases related to USP48 Antibody (NBP1-59766).

Blogs on USP48

There are no specific blogs for USP48, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP48
Entrez
Uniprot