USP47 Antibody

Images

 
Western Blot: USP47 Antibody [NBP1-69151] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: USP47 Antibody [NBP1-69151] - ACHN cell lysate, concentration 0.2-1 ug/ml.
Western Blot: USP47 Antibody [NBP1-69151] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related USP47 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69151
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP47 Antibody Summary

Immunogen
Synthetic peptides corresponding to USP47 (ubiquitin specific peptidase 47) The peptide sequence was selected from the middle region of USP47. Peptide sequence SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP.
Clonality
Polyclonal
Host
Rabbit
Gene
USP47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against USP47 and was validated on Western blot.
Theoretical MW
147 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USP47 Antibody

  • Deubiquitinating enzyme 47
  • DKFZp686C13257
  • EC 3.4.19.12
  • FLJ20727
  • Trf (TATA binding protein-related factor)-proximal homolog (Drosophila)
  • Trf (TATA binding protein-related factor)-proximal homolog
  • TRFP
  • ubiquitin carboxyl-terminal hydrolase 47
  • ubiquitin specific peptidase 47
  • ubiquitin specific protease 47
  • ubiquitin thioesterase 47
  • Ubiquitin thiolesterase 47
  • Ubiquitin-specific-processing protease 47

Background

USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF1555
Species: Hu
Applications: WB
MAB6798
Species: Hu
Applications: WB, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-81174
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for USP47 Antibody (NBP1-69151) (0)

There are no publications for USP47 Antibody (NBP1-69151).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP47 Antibody (NBP1-69151) (0)

There are no reviews for USP47 Antibody (NBP1-69151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP47 Antibody (NBP1-69151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP47 Products

Bioinformatics Tool for USP47 Antibody (NBP1-69151)

Discover related pathways, diseases and genes to USP47 Antibody (NBP1-69151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP47 Antibody (NBP1-69151)

Discover more about diseases related to USP47 Antibody (NBP1-69151).
 

Pathways for USP47 Antibody (NBP1-69151)

View related products by pathway.

Blogs on USP47

There are no specific blogs for USP47, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP47
Uniprot