USP4 Antibody (9E133)

Images

 
Western Blot: USP4 Antibody (5E12) [H00007375-M01] - Analysis of USP4 expression in transfected 293T cell line by USP4 monoclonal antibody (M01), clone 5E12.Lane 1: USP4 transfected lysate (Predicted MW: 108.6 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
9E133
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP4 Antibody (9E133) Summary

Immunogen
USP4 (NP_003354 676 a.a. - 773 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK
Localization
Cytoplasmic
Specificity
USP4 - ubiquitin specific protease 4 (proto-oncogene)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
USP4 Lysate (NBP2-64979)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP4 Antibody (9E133)

  • Deubiquitinating enzyme 4
  • EC 3.1.2.15
  • EC 3.4.19.12
  • MGC149848
  • MGC149849
  • ubiquitin carboxyl-terminal esterase 4
  • ubiquitin carboxyl-terminal hydrolase 4
  • ubiquitin specific peptidase 4 (proto-oncogene)
  • ubiquitin specific protease 4 (proto-oncogene)
  • ubiquitin thioesterase 4
  • Ubiquitin thiolesterase 4
  • ubiquitin-specific processing protease 4
  • Ubiquitin-specific-processing protease 4
  • Ubiquitous nuclear protein homolog
  • UNP
  • Unph
  • UNPUnph
  • USP4

Background

Modification of target proteins by ubiquitin participates in a wide array of biological functions. Proteins destined for degradation or processing via the 26 S proteasome are coupled to multiple copies of ubiquitin. However, attachment of ubiquitin or ubiquitin-related molecules may also result in changes in subcellular distribution or modification of protein activity. An additional level of ubiquitin regulation, deubiquitination, is catalyzed by proteases called deubiquitinating enzymes, which fall into four distinct families. Ubiquitin C-terminal hydrolases, ubiquitin-specific processing proteases (USPs),1 OTU-domain ubiquitin-aldehyde-binding proteins, and Jab1/Pad1/MPN-domain-containing metallo-enzymes. Among these four families, USPs represent the most widespread and represented deubiquitinating enzymes across evolution. USPs tend to release ubiquitin from a conjugated protein. They display similar catalytic domains containing conserved Cys and His boxes but divergent N-terminal and occasionally C-terminal extensions, which are thought to function in substrate recognition, subcellular localization, and protein-protein interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009958-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009098-M01
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-513
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-26506
Species: Hu, Mu, Rt
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45718
Species: Hu
Applications: WB, Flow, IHC
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-75700
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3025
Species: Hu
Applications: WB, ELISA, ICC

Publications for USP4 Antibody (H00007375-M01) (0)

There are no publications for USP4 Antibody (H00007375-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP4 Antibody (H00007375-M01) (0)

There are no reviews for USP4 Antibody (H00007375-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP4 Antibody (H00007375-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for USP4 Antibody (H00007375-M01)

Discover related pathways, diseases and genes to USP4 Antibody (H00007375-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP4 Antibody (H00007375-M01)

Discover more about diseases related to USP4 Antibody (H00007375-M01).
 

Pathways for USP4 Antibody (H00007375-M01)

View related products by pathway.

PTMs for USP4 Antibody (H00007375-M01)

Learn more about PTMs related to USP4 Antibody (H00007375-M01).

Blogs on USP4

There are no specific blogs for USP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP4 Antibody (9E133) and receive a gift card or discount.

Bioinformatics

Gene Symbol USP4
Entrez
OMIM
Uniprot