USP34 Antibody

Images

 
Western Blot: USP34 Antibody [NBP2-57737] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: USP34 Antibody [NBP2-57737] - Staining of human cell line SK-MEL-30 shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP34 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCANLISTLITNLISQYQNLQSDFSNRV
Specificity
Specificity of human USP34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP34
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
USP34 Lysate (NBP2-65373)
Control Peptide
USP34 Recombinant Protein Antigen (NBP2-57737PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for USP34 Antibody

  • Deubiquitinating enzyme 34
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ43910
  • KIAA0570MGC104459
  • KIAA0729ubiquitin carboxyl-terminal hydrolase 34
  • ubiquitin specific peptidase 34
  • ubiquitin specific protease 34
  • ubiquitin thioesterase 34
  • Ubiquitin thiolesterase 34
  • Ubiquitin-specific-processing protease 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-57737
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for USP34 Antibody (NBP2-57737) (0)

There are no publications for USP34 Antibody (NBP2-57737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP34 Antibody (NBP2-57737) (0)

There are no reviews for USP34 Antibody (NBP2-57737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP34 Antibody (NBP2-57737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for USP34 Antibody (NBP2-57737)

Discover related pathways, diseases and genes to USP34 Antibody (NBP2-57737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP34 Antibody (NBP2-57737)

Discover more about diseases related to USP34 Antibody (NBP2-57737).
 

Pathways for USP34 Antibody (NBP2-57737)

View related products by pathway.

PTMs for USP34 Antibody (NBP2-57737)

Learn more about PTMs related to USP34 Antibody (NBP2-57737).

Blogs on USP34

There are no specific blogs for USP34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP34