USP34 Antibody (2E2) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related USP34 Primary Antibodies

Order Details


    • Catalog Number
      H00009736-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP34 Antibody (2E2) [DyLight 755] Summary

Immunogen
USP34 (NP_055524, 3296 a.a. ~ 3396 a.a) partial recombinant protein with GST tag.CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDG QALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIEST IHVVTRISGKGNQAAS
Specificity
USP34 - ubiquitin specific protease 34
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP34
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 755
Format
DyLight 755 (A=754, E=776)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP34 Antibody (2E2) [DyLight 755]

  • Deubiquitinating enzyme 34
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ43910
  • KIAA0570MGC104459
  • KIAA0729ubiquitin carboxyl-terminal hydrolase 34
  • ubiquitin specific peptidase 34
  • ubiquitin specific protease 34
  • ubiquitin thioesterase 34
  • Ubiquitin thiolesterase 34
  • Ubiquitin-specific-processing protease 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1776
Species: Hu, Mu, Rt
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP1-85534
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004086-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: ICFlow
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
H00009736-M01IR
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for USP34 Antibody (H00009736-M01IR) (0)

There are no publications for USP34 Antibody (H00009736-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP34 Antibody (H00009736-M01IR) (0)

There are no reviews for USP34 Antibody (H00009736-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP34 Antibody (H00009736-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP34 Antibody (2E2) [DyLight 755] Products

Related Products by Gene

Bioinformatics Tool for USP34 Antibody (H00009736-M01IR)

Discover related pathways, diseases and genes to USP34 Antibody (H00009736-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP34 Antibody (H00009736-M01IR)

Discover more about diseases related to USP34 Antibody (H00009736-M01IR).
 

Pathways for USP34 Antibody (H00009736-M01IR)

View related products by pathway.

PTMs for USP34 Antibody (H00009736-M01IR)

Learn more about PTMs related to USP34 Antibody (H00009736-M01IR).

Blogs on USP34

There are no specific blogs for USP34, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol USP34

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00009736-M01IR below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.