USP34 Antibody (2E2) [DyLight 755] (H00009736-M01IR)

Images

 

Product Details

Summary
Product Discontinued
View other related USP34 Primary Antibodies

Order Details


    • Catalog Number
      H00009736-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP34 Antibody (2E2) [DyLight 755] Summary

Immunogen
USP34 (NP_055524, 3296 a.a. ~ 3396 a.a) partial recombinant protein with GST tag.CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDG QALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIEST IHVVTRISGKGNQAAS
Specificity
USP34 - ubiquitin specific protease 34
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP34
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP34 Antibody (2E2) [DyLight 755]

  • Deubiquitinating enzyme 34
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ43910
  • KIAA0570MGC104459
  • KIAA0729ubiquitin carboxyl-terminal hydrolase 34
  • ubiquitin specific peptidase 34
  • ubiquitin specific protease 34
  • ubiquitin thioesterase 34
  • Ubiquitin thiolesterase 34
  • Ubiquitin-specific-processing protease 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
H00009736-M01IR
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for USP34 Antibody (H00009736-M01IR) (0)

There are no publications for USP34 Antibody (H00009736-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP34 Antibody (H00009736-M01IR) (0)

There are no reviews for USP34 Antibody (H00009736-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP34 Antibody (H00009736-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP34 Products

Related Products by Gene

Bioinformatics Tool for USP34 Antibody (H00009736-M01IR)

Discover related pathways, diseases and genes to USP34 Antibody (H00009736-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP34 Antibody (H00009736-M01IR)

Discover more about diseases related to USP34 Antibody (H00009736-M01IR).
 

Pathways for USP34 Antibody (H00009736-M01IR)

View related products by pathway.

PTMs for USP34 Antibody (H00009736-M01IR)

Learn more about PTMs related to USP34 Antibody (H00009736-M01IR).

Blogs on USP34

There are no specific blogs for USP34, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP34 Antibody (2E2) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol USP34