Recombinant Human USP30 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related USP30 Peptides and Proteins

Order Details


    • Catalog Number
      H00084749-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human USP30 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 508 of Human USP30 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
USP30

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP30 Protein

  • Deubiquitinating Enzyme 30
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ40511
  • MGC10702
  • ubiquitin carboxyl-terminal hydrolase 30
  • ubiquitin specific peptidase 30
  • ubiquitin specific protease 30
  • Ubiquitin Thioesterase 30
  • Ubiquitin thiolesterase 30
  • ubiquitin-specific protease 30
  • Ubiquitin-specific-processing protease 30
  • Ub-specific protease 30
  • USP30

Background

USP30( AAH04868, 1 a.a. - 509 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21583
Species: Hu
Applications: WB, ICC/IF
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-93456
Species: Hu
Applications: IHC, IHC-P
NB110-40693
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-57487
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
H00084749-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP30 Recombinant Protein (H00084749-P01) (0)

There are no publications for USP30 Recombinant Protein (H00084749-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP30 Recombinant Protein (H00084749-P01) (0)

There are no reviews for USP30 Recombinant Protein (H00084749-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP30 Recombinant Protein (H00084749-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP30 Products

Bioinformatics Tool for USP30 Recombinant Protein (H00084749-P01)

Discover related pathways, diseases and genes to USP30 Recombinant Protein (H00084749-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP30 Recombinant Protein (H00084749-P01)

Discover more about diseases related to USP30 Recombinant Protein (H00084749-P01).
 

Pathways for USP30 Recombinant Protein (H00084749-P01)

View related products by pathway.

PTMs for USP30 Recombinant Protein (H00084749-P01)

Learn more about PTMs related to USP30 Recombinant Protein (H00084749-P01).

Blogs on USP30

There are no specific blogs for USP30, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP30 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP30
Entrez