Recombinant Human USP28 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related USP28 Peptides and Proteins

Order Details


    • Catalog Number
      H00057646-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human USP28 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 978-1077 of Human USP28 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP28

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM PBS, 20 mM NaCl 0.5 M, pH 7.8 (1 mM DTT, 8 M urea)

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP28 Protein

  • Deubiquitinating enzyme 28
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1515ubiquitin carboxyl-terminal hydrolase 28
  • ubiquitin specific peptidase 28
  • ubiquitin specific protease 28
  • ubiquitin thioesterase 28
  • Ubiquitin thiolesterase 28
  • Ubiquitin-specific-processing protease 28
  • USP28

Background

USP28 - ubiquitin specific protease 28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-90744
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
H00057646-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP28 Partial Recombinant Protein (H00057646-Q01) (0)

There are no publications for USP28 Partial Recombinant Protein (H00057646-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP28 Partial Recombinant Protein (H00057646-Q01) (0)

There are no reviews for USP28 Partial Recombinant Protein (H00057646-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP28 Partial Recombinant Protein (H00057646-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP28 Products

Bioinformatics Tool for USP28 Partial Recombinant Protein (H00057646-Q01)

Discover related pathways, diseases and genes to USP28 Partial Recombinant Protein (H00057646-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP28 Partial Recombinant Protein (H00057646-Q01)

Discover more about diseases related to USP28 Partial Recombinant Protein (H00057646-Q01).
 

Pathways for USP28 Partial Recombinant Protein (H00057646-Q01)

View related products by pathway.

PTMs for USP28 Partial Recombinant Protein (H00057646-Q01)

Learn more about PTMs related to USP28 Partial Recombinant Protein (H00057646-Q01).

Blogs on USP28

There are no specific blogs for USP28, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP28 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP28
Entrez