Recombinant Human USP18 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related USP18 Peptides and Proteins

Order Details


    • Catalog Number
      H00011274-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human USP18 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 273-372 of Human USP18 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMKMEC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP18

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP18 Protein

  • EC 3.1.2.15
  • EC 3.4.19.-
  • hUBP43
  • ISG15-specific-processing protease
  • ISG43
  • ISG43UBP43
  • ubiquitin specific peptidase 18
  • ubiquitin specific protease 18
  • ubl carboxyl-terminal hydrolase 18
  • ubl thioesterase 18,43 kDa ISG15-specific protease
  • Ubl thiolesterase 18
  • UBP43
  • USP18

Background

USP18 - ubiquitin specific protease 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
A-306
Species: Hu
Applications: WB, IHC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
AF1083
Species: Mu
Applications: WB, Neut
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00011274-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for USP18 Partial Recombinant Protein (H00011274-Q01) (0)

There are no publications for USP18 Partial Recombinant Protein (H00011274-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP18 Partial Recombinant Protein (H00011274-Q01) (0)

There are no reviews for USP18 Partial Recombinant Protein (H00011274-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP18 Partial Recombinant Protein (H00011274-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP18 Products

Bioinformatics Tool for USP18 Partial Recombinant Protein (H00011274-Q01)

Discover related pathways, diseases and genes to USP18 Partial Recombinant Protein (H00011274-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP18 Partial Recombinant Protein (H00011274-Q01)

Discover more about diseases related to USP18 Partial Recombinant Protein (H00011274-Q01).
 

Pathways for USP18 Partial Recombinant Protein (H00011274-Q01)

View related products by pathway.

PTMs for USP18 Partial Recombinant Protein (H00011274-Q01)

Learn more about PTMs related to USP18 Partial Recombinant Protein (H00011274-Q01).
 

Research Areas for USP18 Partial Recombinant Protein (H00011274-Q01)

Find related products by research area.

Blogs on USP18

There are no specific blogs for USP18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP18
Entrez