USP18 Antibody

Images

 
Western Blot: USP18 Antibody [NBP1-56912] - USP18 antibody - N-terminal region validated by WB using Mouse Brain lysate at 2ug/ml.
Western Blot: USP18 Antibody [NBP1-56912] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Hela cell lysate

Product Details

Summary
Product Discontinued
View other related USP18 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56912
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP18 Antibody Summary

Immunogen
Synthetic peptides corresponding to USP18(ubiquitin specific peptidase 18) The peptide sequence was selected from the N terminal of USP18. Peptide sequence MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against USP18 and was validated on Western blot.
Control
USP18 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USP18 Antibody

  • EC 3.1.2.15
  • EC 3.4.19.-
  • hUBP43
  • ISG15-specific-processing protease
  • ISG43
  • ISG43UBP43
  • ubiquitin specific peptidase 18
  • ubiquitin specific protease 18
  • ubl carboxyl-terminal hydrolase 18
  • ubl thioesterase 18,43 kDa ISG15-specific protease
  • Ubl thiolesterase 18
  • UBP43
  • USP18

Background

USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-232 AC008079.24 80964-81195 233-495 AC008079.24 88531-88793 496-592 AC008079.24 91145-91241 593-738 AC008079.24 92763-92908 739-818 AC008079.24 98228-98307 819-965 AC008079.24 98863-99009 966-1061 AC008079.24 100817-100912 1062-1229 AC008079.24 101726-101893 1230-1361 AC008079.24 104123-104254 1362-1411 AC008079.24 104766-104815 1412-2037 AC008079.24 107745-108370

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48011
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
A-306
Species: Hu
Applications: WB, IHC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-32905
Species: Hu, Bv, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67339
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
H00006449-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-88117
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP1-58102
Species: Hu, Rt, Po, Bv, Eq, Rb
Applications: WB, ICC/IF, IHC
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-67634
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67741
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
AF1083
Species: Mu
Applications: WB, Neut
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-56912
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB

Publications for USP18 Antibody (NBP1-56912) (0)

There are no publications for USP18 Antibody (NBP1-56912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP18 Antibody (NBP1-56912) (0)

There are no reviews for USP18 Antibody (NBP1-56912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP18 Antibody (NBP1-56912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional USP18 Products

Bioinformatics Tool for USP18 Antibody (NBP1-56912)

Discover related pathways, diseases and genes to USP18 Antibody (NBP1-56912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP18 Antibody (NBP1-56912)

Discover more about diseases related to USP18 Antibody (NBP1-56912).
 

Pathways for USP18 Antibody (NBP1-56912)

View related products by pathway.

PTMs for USP18 Antibody (NBP1-56912)

Learn more about PTMs related to USP18 Antibody (NBP1-56912).
 

Research Areas for USP18 Antibody (NBP1-56912)

Find related products by research area.

Blogs on USP18

There are no specific blogs for USP18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP18
Uniprot