Recombinant Human USP10 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related USP10 Peptides and Proteins

Order Details


    • Catalog Number
      H00009100-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human USP10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 699-797 of Human USP10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDL

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP10

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP10 Protein

  • Deubiquitinating enzyme 10
  • EC 3.4.19.12
  • KIAA0190MGC2621
  • ubiquitin carboxyl-terminal hydrolase 10
  • ubiquitin specific peptidase 10
  • ubiquitin specific protease 10
  • ubiquitin thioesterase 10
  • Ubiquitin Thiolesterase 10
  • Ubiquitin-specific-processing protease 10
  • UBPO
  • Uchrp
  • USP10

Background

USP10 - ubiquitin specific protease 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-46132
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for USP10 Partial Recombinant Protein (H00009100-Q01) (0)

There are no publications for USP10 Partial Recombinant Protein (H00009100-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP10 Partial Recombinant Protein (H00009100-Q01) (0)

There are no reviews for USP10 Partial Recombinant Protein (H00009100-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP10 Partial Recombinant Protein (H00009100-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP10 Products

Bioinformatics Tool for USP10 Partial Recombinant Protein (H00009100-Q01)

Discover related pathways, diseases and genes to USP10 Partial Recombinant Protein (H00009100-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP10 Partial Recombinant Protein (H00009100-Q01)

Discover more about diseases related to USP10 Partial Recombinant Protein (H00009100-Q01).
 

Pathways for USP10 Partial Recombinant Protein (H00009100-Q01)

View related products by pathway.

PTMs for USP10 Partial Recombinant Protein (H00009100-Q01)

Learn more about PTMs related to USP10 Partial Recombinant Protein (H00009100-Q01).

Blogs on USP10.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP10
Entrez