UROC1 Antibody

Images

 
Immunohistochemistry: UROC1 Antibody [NBP2-32659] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes and bile duct cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UROC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UROC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UROC1 Protein (NBP2-32659PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UROC1 Antibody

  • imidazolonepropionate hydrolase
  • urocanase domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27348
Species: Hu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-54755
Species: Hu
Applications: WB
NBP2-12553
Species: Hu
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32659
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for UROC1 Antibody (NBP2-32659) (0)

There are no publications for UROC1 Antibody (NBP2-32659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UROC1 Antibody (NBP2-32659) (0)

There are no reviews for UROC1 Antibody (NBP2-32659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UROC1 Antibody (NBP2-32659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UROC1 Products

Bioinformatics Tool for UROC1 Antibody (NBP2-32659)

Discover related pathways, diseases and genes to UROC1 Antibody (NBP2-32659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UROC1 Antibody (NBP2-32659)

Discover more about diseases related to UROC1 Antibody (NBP2-32659).

Blogs on UROC1

There are no specific blogs for UROC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UROC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UROC1