UPP2 Antibody

Images

 
Western Blot: UPP2 Antibody [NBP1-74150] - Titration: 1.0 ug/ml Positive Control: Mouse Brain.

Product Details

Summary
Product Discontinued
View other related UPP2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74150
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UPP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Upp2. Immunizing peptide sequence SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG.
Clonality
Polyclonal
Host
Rabbit
Gene
UPP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Upp2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UPP2 Antibody

  • EC 2.4.2.3
  • liver-specific uridine phosphorylase
  • UDRPASE2
  • UP2
  • UPase 2
  • UPASE2
  • UrdPase 2
  • uridine phosphorylase 2
  • uridine phosphorylase-2

Background

Upp2 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30852
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12482
Species: Hu
Applications: IHC, IHC-P
NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-46297
Species: Hu
Applications: WB, IHC
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF1936
Species: Hu
Applications: WB, IP
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-74150
Species: Mu
Applications: WB

Publications for UPP2 Antibody (NBP1-74150) (0)

There are no publications for UPP2 Antibody (NBP1-74150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPP2 Antibody (NBP1-74150) (0)

There are no reviews for UPP2 Antibody (NBP1-74150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UPP2 Antibody (NBP1-74150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UPP2 Products

Bioinformatics Tool for UPP2 Antibody (NBP1-74150)

Discover related pathways, diseases and genes to UPP2 Antibody (NBP1-74150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UPP2 Antibody (NBP1-74150)

Discover more about diseases related to UPP2 Antibody (NBP1-74150).
 

Pathways for UPP2 Antibody (NBP1-74150)

View related products by pathway.

Blogs on UPP2

There are no specific blogs for UPP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UPP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPP2
Uniprot