UNG Antibody

Images

 
Western Blot: UNG Antibody [H00007374-B01P] - Analysis of UNG expression in human placenta.
Immunocytochemistry/ Immunofluorescence: UNG Antibody [H00007374-B01P] - Analysis of purified antibody to UNG on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: UNG Antibody [H00007374-B01P] - Analysis of UNG expression in transfected 293T cell line by UNG polyclonal antibody. Lane 1: UNG transfected lysate(33.44 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UNG Antibody Summary

Immunogen
UNG (NP_003353.1, 1 a.a. - 304 a.a.) full-length human protein. MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Specificity
UNG - uracil-DNA glycosylase,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UNG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.
Publications
Read Publication using H00007374-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UNG Antibody

  • DGU
  • DGUEC 3.2.2
  • HIGM4EC 3.2.2.27
  • UDG
  • UDGDKFZp781L1143
  • UNG
  • UNG15
  • UNG1uracil-DNA glycosylase 1, uracil-DNA glycosylase 2
  • UNG2
  • uracil-DNA glycosylase

Background

This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-33277
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46091
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-98285
Species: Hu
Applications: WB
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-24393
Species: Hu
Applications: WB
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for UNG Antibody (H00007374-B01P)(1)

Reviews for UNG Antibody (H00007374-B01P) (0)

There are no reviews for UNG Antibody (H00007374-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UNG Antibody (H00007374-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNG Products

Bioinformatics Tool for UNG Antibody (H00007374-B01P)

Discover related pathways, diseases and genes to UNG Antibody (H00007374-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNG Antibody (H00007374-B01P)

Discover more about diseases related to UNG Antibody (H00007374-B01P).
 

Pathways for UNG Antibody (H00007374-B01P)

View related products by pathway.

PTMs for UNG Antibody (H00007374-B01P)

Learn more about PTMs related to UNG Antibody (H00007374-B01P).
 

Research Areas for UNG Antibody (H00007374-B01P)

Find related products by research area.

Blogs on UNG

There are no specific blogs for UNG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UNG
Entrez
Uniprot