UNC5H3/UNC5C Antibody



Product Details

Product Discontinued
View other related UNC5H3/UNC5C Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UNC5H3/UNC5C Antibody Summary

Synthetic peptides corresponding to UNC5C(unc-5 homolog C (C. elegans)) The peptide sequence was selected from the middle region of UNC5C. Peptide sequence VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against UNC5C and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
103 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Block
Species: Rt
Applications: WB, IHC
Species: Rt
Applications: WB, Block, ICC
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Mu, Rt
Applications: WB, Neut
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB

Publications for UNC5H3/UNC5C Antibody (NBP1-69282) (0)

There are no publications for UNC5H3/UNC5C Antibody (NBP1-69282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC5H3/UNC5C Antibody (NBP1-69282) (0)

There are no reviews for UNC5H3/UNC5C Antibody (NBP1-69282). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for UNC5H3/UNC5C Antibody (NBP1-69282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UNC5H3/UNC5C Antibody Products

Related Products by Gene

Bioinformatics Tool for UNC5H3/UNC5C Antibody (NBP1-69282)

Discover related pathways, diseases and genes to UNC5H3/UNC5C Antibody (NBP1-69282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC5H3/UNC5C Antibody (NBP1-69282)

Discover more about diseases related to UNC5H3/UNC5C Antibody (NBP1-69282).

Pathways for UNC5H3/UNC5C Antibody (NBP1-69282)

View related products by pathway.

PTMs for UNC5H3/UNC5C Antibody (NBP1-69282)

Learn more about PTMs related to UNC5H3/UNC5C Antibody (NBP1-69282).

Blogs on UNC5H3/UNC5C

There are no specific blogs for UNC5H3/UNC5C, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol UNC5C

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69282 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.