UMPS Antibody


Western Blot: UMPS Antibody [NBP1-54867] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: UMPS Antibody [NBP1-54867] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working more
Western Blot: UMPS Antibody [NBP1-54867] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: UMPS Antibody [NBP1-54867] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: UMPS Antibody [NBP1-54867] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: UMPS Antibody [NBP1-54867] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: UMPS Antibody [NBP1-54867] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: UMPS Antibody [NBP1-54867] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 721_B cell lysate UMPS is strongly supported by BioGPS gene expression data to be expressed in Human more

Product Details

Product Discontinued
View other related UMPS Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UMPS Antibody Summary

Synthetic peptides corresponding to UMPS(uridine monophosphate synthetase) The peptide sequence was selected from the C terminal of UMPS. Peptide sequence VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against UMPS and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UMPS Antibody

  • EC
  • OMPdecase
  • OPRT
  • OPRTase
  • orotate phosphoribosyltransferase
  • orotidine 5'-phosphate decarboxylase
  • UMP synthase
  • uridine 5'-monophosphate synthase
  • uridine monophosphate synthetase


OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for UMPS Antibody (NBP1-54867) (0)

There are no publications for UMPS Antibody (NBP1-54867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UMPS Antibody (NBP1-54867) (0)

There are no reviews for UMPS Antibody (NBP1-54867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UMPS Antibody (NBP1-54867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UMPS Products

Bioinformatics Tool for UMPS Antibody (NBP1-54867)

Discover related pathways, diseases and genes to UMPS Antibody (NBP1-54867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UMPS Antibody (NBP1-54867)

Discover more about diseases related to UMPS Antibody (NBP1-54867).

Pathways for UMPS Antibody (NBP1-54867)

View related products by pathway.

PTMs for UMPS Antibody (NBP1-54867)

Learn more about PTMs related to UMPS Antibody (NBP1-54867).

Blogs on UMPS

There are no specific blogs for UMPS, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UMPS Antibody and receive a gift card or discount.


Gene Symbol UMPS