ULK1 Antibody (2H8)

Images

 
Western Blot: ULK1 Antibody (2H8) [H00008408-M01] - ULK1 monoclonal antibody (M01), clone 2H8. Analysis of ULK1 expression in human stomach.
ELISA: ULK1 Antibody (2H8) [H00008408-M01] - Detection limit for recombinant GST tagged ULK1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ULK1 Antibody (2H8) Summary

Immunogen
ULK1 (NP_003556.1 602 a.a. - 715 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPG
Specificity
ULK1 - unc-51-like kinase 1 (C. elegans)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ULK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ULK1 Antibody (2H8)

  • ATG1 autophagy related 1 homolog
  • ATG1
  • ATG1A
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ38455
  • FLJ46475
  • KIAA0722
  • serine/threonine-protein kinase ULK1
  • unc-51 (C. elegans)-like kinase 1
  • UNC51
  • Unc51.1
  • unc-51-like kinase 1 (C. elegans)
  • Unc-51-like kinase 1

Background

ULK1 belongs to the serine/threonine protein kinase family. It is involved in axon growth and plays an essential role in neurite branching during sensory axon outgrowth. Knockdown of ULK1 results in impaired endocytosis of nerve growth factor (NGF), excessive axon arborization, and severely stunted axon elongation indicating that ULK1 mediates a non-clathrin-coated endocytosis in sensory growth cones. Knockdown of ULK1 also inhibits the autophagic response. It appears to act as a convergence point for multiple signals that regulate autophagy, and in turn interacts with a large number of autophagy-related (Atg) proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-52419
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-33136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77279
Species: Hu, Mu
Applications: WB, IP
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008408-M01
Species: Hu
Applications: WB, ELISA

Publications for ULK1 Antibody (H00008408-M01) (0)

There are no publications for ULK1 Antibody (H00008408-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ULK1 Antibody (H00008408-M01) (0)

There are no reviews for ULK1 Antibody (H00008408-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ULK1 Antibody (H00008408-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ULK1 Products

Bioinformatics Tool for ULK1 Antibody (H00008408-M01)

Discover related pathways, diseases and genes to ULK1 Antibody (H00008408-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ULK1 Antibody (H00008408-M01)

Discover more about diseases related to ULK1 Antibody (H00008408-M01).
 

Pathways for ULK1 Antibody (H00008408-M01)

View related products by pathway.

PTMs for ULK1 Antibody (H00008408-M01)

Learn more about PTMs related to ULK1 Antibody (H00008408-M01).
 

Research Areas for ULK1 Antibody (H00008408-M01)

Find related products by research area.

Blogs on ULK1.

VPS34 - autophagy initiator and regulator of endosomal trafficking
VPS34, vacuolar protein sorting 34, is the only identified Class III phosphoinositide-3 kinase (PI3K) in mammals and is ubiquitously expressed in all eukaryotic cells. VPS34 is a 100 kDa protein responsible for phosphorylating phosphatidylinositol...  Read full blog post.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ULK1 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ULK1
Entrez
OMIM
Uniprot