UHRF1 Antibody

Images

 
Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP1-88254] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UHRF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VQSEALAPDSMSHPRSKTEHDLKSLSGLTEVMEILKEGSSGMDNKGPLTELEDVADVHMLVHSPAHVRVRLDHYQYLALLRLKEVLQRLQEQLTKDTESMTGSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UHRF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UHRF1 Protein (NBP1-88254PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UHRF1 Antibody

  • E3 ubiquitin-protein ligase UHRF1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ21925
  • hNP95
  • huNp95
  • ICBP90NP95
  • Inverted CCAAT box-binding protein of 90 kDa
  • Np95
  • Nuclear protein 95
  • Nuclear zinc finger protein Np95
  • RING finger protein 106
  • RNF106MGC138707
  • Transcription factor ICBP90
  • Ubiquitin-like PHD and RING finger domain-containing protein 1
  • ubiquitin-like with PHD and ring finger domains 1
  • ubiquitin-like, containing PHD and RING finger domains, 1
  • Ubiquitin-like-containing PHD and RING finger domains protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00115426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
NB100-2270
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-18933
Species: Hu, Mu
Applications: WB, IP
AF1709
Species: Mu
Applications: WB, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84161
Species: Hu
Applications: IHC, IHC-P

Publications for UHRF1 Antibody (NBP1-88254) (0)

There are no publications for UHRF1 Antibody (NBP1-88254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UHRF1 Antibody (NBP1-88254) (0)

There are no reviews for UHRF1 Antibody (NBP1-88254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UHRF1 Antibody (NBP1-88254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UHRF1 Products

Bioinformatics Tool for UHRF1 Antibody (NBP1-88254)

Discover related pathways, diseases and genes to UHRF1 Antibody (NBP1-88254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UHRF1 Antibody (NBP1-88254)

Discover more about diseases related to UHRF1 Antibody (NBP1-88254).
 

Pathways for UHRF1 Antibody (NBP1-88254)

View related products by pathway.

PTMs for UHRF1 Antibody (NBP1-88254)

Learn more about PTMs related to UHRF1 Antibody (NBP1-88254).
 

Research Areas for UHRF1 Antibody (NBP1-88254)

Find related products by research area.

Blogs on UHRF1

There are no specific blogs for UHRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UHRF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF1