Recombinant Human UCP4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related UCP4 Peptides and Proteins

Order Details


    • Catalog Number
      H00009481-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human UCP4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-245 of Human SLC25A27 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLVNPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC25A27
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
52.69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UCP4 Protein

  • FLJ33552
  • mitochondrial uncoupling protein 4
  • Solute carrier family 25 member 27
  • solute carrier family 25, member 27
  • UCP 4
  • UCP4uncoupling protein 4

Background

SLC25A27( AAH33091, 1 a.a. - 246 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59598
Species: Hu
Applications: WB
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-50179
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, In vitro
NBP1-87365
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-87436
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00009481-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for UCP4 Recombinant Protein (H00009481-P01) (0)

There are no publications for UCP4 Recombinant Protein (H00009481-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP4 Recombinant Protein (H00009481-P01) (0)

There are no reviews for UCP4 Recombinant Protein (H00009481-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP4 Recombinant Protein (H00009481-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCP4 Products

Bioinformatics Tool for UCP4 Recombinant Protein (H00009481-P01)

Discover related pathways, diseases and genes to UCP4 Recombinant Protein (H00009481-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP4 Recombinant Protein (H00009481-P01)

Discover more about diseases related to UCP4 Recombinant Protein (H00009481-P01).
 

Pathways for UCP4 Recombinant Protein (H00009481-P01)

View related products by pathway.

PTMs for UCP4 Recombinant Protein (H00009481-P01)

Learn more about PTMs related to UCP4 Recombinant Protein (H00009481-P01).

Blogs on UCP4

There are no specific blogs for UCP4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UCP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A27