UCH-L3 Antibody


Western Blot: UCH-L3 Antibody [NBP1-55316] - MCF7 cell lysate, Antibody Titration: 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-55316] - Human placenta tissue at an antibody concentration of 4-8ug/ml.
Western Blot: UCH-L3 Antibody [NBP1-55316] - Antibody Positive control: Lane 1 : 30ug Zebrafish skin lysate Lane 2: 30ug Zebrafish liver lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP ...read more

Product Details

Reactivity Hu, ZeSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

UCH-L3 Antibody Summary

Synthetic peptides corresponding to UCHL3(ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)) The peptide sequence was selected from the N terminal of UCHL3. Peptide sequence MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against UCHL3 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UCH-L3 Antibody

  • EC
  • ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
  • ubiquitin carboxyl-terminal hydrolase isozyme L3
  • Ubiquitin Thioesterase L3
  • ubiquitin thiolesterase
  • UCHL3
  • UCH-L3


UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF

Publications for UCH-L3 Antibody (NBP1-55316) (0)

There are no publications for UCH-L3 Antibody (NBP1-55316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCH-L3 Antibody (NBP1-55316) (0)

There are no reviews for UCH-L3 Antibody (NBP1-55316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCH-L3 Antibody (NBP1-55316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UCH-L3 Products

Bioinformatics Tool for UCH-L3 Antibody (NBP1-55316)

Discover related pathways, diseases and genes to UCH-L3 Antibody (NBP1-55316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCH-L3 Antibody (NBP1-55316)

Discover more about diseases related to UCH-L3 Antibody (NBP1-55316).

Pathways for UCH-L3 Antibody (NBP1-55316)

View related products by pathway.

PTMs for UCH-L3 Antibody (NBP1-55316)

Learn more about PTMs related to UCH-L3 Antibody (NBP1-55316).

Blogs on UCH-L3

There are no specific blogs for UCH-L3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UCH-L3 Antibody and receive a gift card or discount.


Gene Symbol UCHL3