UBPY/USP8 Antibody

Images

 
Western Blot: UBPY/USP8 Antibody [NBP1-89643] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP1-89643] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts

Product Details

Summary
Product Discontinued
View other related UBPY/USP8 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89643
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UBPY/USP8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDENIELISGQNERMGPLNI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
UBPY/USP8 Lysate (NBP2-65098)
Publications
Read Publication using
NBP1-89643 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25485838).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBPY/USP8 Antibody

  • Deubiquitinating enzyme 8
  • EC 3.1.2.15
  • EC 3.4.19.12
  • HumORF8
  • KIAA0055hUBPy
  • MGC129718
  • ubiquitin carboxyl-terminal hydrolase 8
  • Ubiquitin isopeptidase Y
  • ubiquitin specific peptidase 8
  • ubiquitin specific protease 8
  • ubiquitin thioesterase 8
  • Ubiquitin thiolesterase 8
  • Ubiquitin-specific-processing protease 8
  • UBPY
  • UBPYFLJ34456
  • USP8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
AF5650
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56533
Species: Hu
Applications: WB
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-264
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP1-89180
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UBPY/USP8 Antibody (NBP1-89643)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UBPY/USP8 Antibody (NBP1-89643) (0)

There are no reviews for UBPY/USP8 Antibody (NBP1-89643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBPY/USP8 Antibody (NBP1-89643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional UBPY/USP8 Products

Bioinformatics Tool for UBPY/USP8 Antibody (NBP1-89643)

Discover related pathways, diseases and genes to UBPY/USP8 Antibody (NBP1-89643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBPY/USP8 Antibody (NBP1-89643)

Discover more about diseases related to UBPY/USP8 Antibody (NBP1-89643).
 

Pathways for UBPY/USP8 Antibody (NBP1-89643)

View related products by pathway.

PTMs for UBPY/USP8 Antibody (NBP1-89643)

Learn more about PTMs related to UBPY/USP8 Antibody (NBP1-89643).

Blogs on UBPY/USP8

There are no specific blogs for UBPY/USP8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBPY/USP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP8
Entrez