Recombinant Human Ubiquitin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Ubiquitin Peptides and Proteins

Order Details


    • Catalog Number
      H00006233-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Ubiquitin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-156 of Human RPS27A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
RPS27A

Applications/Dilutions

Application Notes
This antibody is useful for ELISA and Western Blot. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ubiquitin Protein

  • RPS27A
  • UBA52
  • UBB ubiquitin B
  • UBB
  • UBC
  • Ubiquitin

Background

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP2-46261
Species: Hu
Applications: WB, IHC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56360
Species: Hu
Applications: WB
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-56357
Species: Hu
Applications: WB, IP
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006233-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Ubiquitin Recombinant Protein (H00006233-P01) (0)

There are no publications for Ubiquitin Recombinant Protein (H00006233-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquitin Recombinant Protein (H00006233-P01) (0)

There are no reviews for Ubiquitin Recombinant Protein (H00006233-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ubiquitin Recombinant Protein (H00006233-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ubiquitin Products

Bioinformatics Tool for Ubiquitin Recombinant Protein (H00006233-P01)

Discover related pathways, diseases and genes to Ubiquitin Recombinant Protein (H00006233-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquitin Recombinant Protein (H00006233-P01)

Discover more about diseases related to Ubiquitin Recombinant Protein (H00006233-P01).
 

Pathways for Ubiquitin Recombinant Protein (H00006233-P01)

View related products by pathway.

PTMs for Ubiquitin Recombinant Protein (H00006233-P01)

Learn more about PTMs related to Ubiquitin Recombinant Protein (H00006233-P01).
 

Research Areas for Ubiquitin Recombinant Protein (H00006233-P01)

Find related products by research area.

Blogs on Ubiquitin.

There's an autophagy for that!
By Christina Towers, PhDA critical mechanism that cells use to generate nutrients and fuel metabolism is through a process called autophagy.  This process is complex and involves over 20 different proteins, most of which are highly conserved acro...  Read full blog post.

Article Review: Glucose-induced transcriptional regulation in cancer
Epigenetic mechanisms have been implicated in many physiological and pathophysiological processes. Among these, histone modifications including methylation, phosphorylation, acetylation and ubiquitination, significantly modify gene expression. In c...  Read full blog post.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

Ubiquitin-Mediated Degradation of Cellular Proteins: The Kiss of Death
Ubiquitin is an abundant and essential cellular 9-kd protein that is conserved across evolution from yeast to humans. Ubiquitin is used by cells as a covalent modifier of other proteins both to activate their function and to target them for degradatio...  Read full blog post.

Using Ubiquitin Antibodies in Various Disease Research
Ubiquitin is a small, highly conserved protein which plays an important role in protein breakdown, covalently bonding to proteins to mark them for proteolytic degradation in a process called ubiquitination. Ubiquitin also binds to inclusion bodies (ac...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

The Latest Research on IBR-type E3 Ubiquitin Ligases
E3 ubiquitin ligases are standards in most antibody catalogs. These proteins are essential to the process of ubiquitination, which is expressed in protein pathways throughout the body and is often linked to disease states. It is widely used as a bioma...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ubiquitin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS27A
Entrez