Ubiquitin B Antibody

Images

 
Western Blot: Ubiquitin Antibody [NBP2-54736] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane ...read more
Immunohistochemistry-Paraffin: Ubiquitin Antibody [NBP2-54736] - Staining of human urinary bladder shows nuclear and cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ubiquitin B Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Specificity
Specificity of human Ubiquitin B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ubiquitin B Antibody

  • FLJ25987
  • MGC8385
  • polyubiquitin B
  • polyubiquitin-B
  • RPS27A
  • UBA52
  • UBC
  • ubiquitin B
  • Ubiquitin+1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP1-87329
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56360
Species: Hu
Applications: WB
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-54736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Ubiquitin B Antibody (NBP2-54736) (0)

There are no publications for Ubiquitin B Antibody (NBP2-54736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquitin B Antibody (NBP2-54736) (0)

There are no reviews for Ubiquitin B Antibody (NBP2-54736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ubiquitin B Antibody (NBP2-54736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ubiquitin B Products

Bioinformatics Tool for Ubiquitin B Antibody (NBP2-54736)

Discover related pathways, diseases and genes to Ubiquitin B Antibody (NBP2-54736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquitin B Antibody (NBP2-54736)

Discover more about diseases related to Ubiquitin B Antibody (NBP2-54736).
 

Pathways for Ubiquitin B Antibody (NBP2-54736)

View related products by pathway.

PTMs for Ubiquitin B Antibody (NBP2-54736)

Learn more about PTMs related to Ubiquitin B Antibody (NBP2-54736).

Blogs on Ubiquitin B

There are no specific blogs for Ubiquitin B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ubiquitin B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBB
COVID-19 update