Recombinant Human Ubiquilin 2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Ubiquilin 2 Peptides and Proteins

Order Details


    • Catalog Number
      H00029978-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Ubiquilin 2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 555-624 of Human Ubiquilin 2

Source: Wheat Germ

Amino Acid Sequence: PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
UBQLN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
33.44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ubiquilin 2 Protein

  • Chap1
  • CHAP1/DSK2
  • DSK2 homolog
  • DSK2
  • FLJ10167
  • FLJ56541
  • hPLIC-2
  • N4BP4LIC-2
  • Nedd4 binding protein 4
  • PLIC-2
  • PLIC2Dsk2
  • Protein linking IAP with cytoskeleton 2
  • RIHFB2157
  • ubiquilin 2
  • ubiquilin-2
  • Ubiquitin-like product Chap1/Dsk2

Background

UBQLN2 - ubiquilin 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3341
Species: ChHa, Ha, Hu, Mu
Applications: WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-94330
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-52549
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-31417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-00990
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01294
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84682
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-80715
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00029978-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01) (0)

There are no publications for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01) (0)

There are no reviews for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ubiquilin 2 Products

Bioinformatics Tool for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01)

Discover related pathways, diseases and genes to Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01)

Discover more about diseases related to Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01).
 

Pathways for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01)

View related products by pathway.

PTMs for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01)

Learn more about PTMs related to Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01).
 

Research Areas for Ubiquilin 2 Partial Recombinant Protein (H00029978-Q01)

Find related products by research area.

Blogs on Ubiquilin 2

There are no specific blogs for Ubiquilin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ubiquilin 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBQLN2