Ubiquilin 1 Antibody (1C6-A3) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Ubiquilin 1 Primary Antibodies

Order Details


    • Catalog Number
      H00029979-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ubiquilin 1 Antibody (1C6-A3) [PE] Summary

Immunogen
UBQLN1 (AAH39294, 1 a.a. ~ 590 a.a) full length recombinant protein with GST tag. MAESGESGGPPGSQDSAAGAEGAGTPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNHDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQ
Specificity
UBQLN1 - ubiquilin 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBQLN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ubiquilin 1 Antibody (1C6-A3) [PE]

  • DA41
  • DA41FLJ90054
  • DSK2
  • hPLIC-1
  • PLIC1
  • PLIC-1
  • PLIC-1UBQN
  • Protein linking IAP with cytoskeleton 1
  • Ubiquilin 1
  • ubiquilin-1
  • UBQLN1
  • UBQN
  • XDRP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF5540
Species: Mu
Applications: WB
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP2-52549
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01294
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00029979-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Ubiquilin 1 Antibody (H00029979-M01PE) (0)

There are no publications for Ubiquilin 1 Antibody (H00029979-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquilin 1 Antibody (H00029979-M01PE) (0)

There are no reviews for Ubiquilin 1 Antibody (H00029979-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ubiquilin 1 Antibody (H00029979-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ubiquilin 1 Products

Bioinformatics Tool for Ubiquilin 1 Antibody (H00029979-M01PE)

Discover related pathways, diseases and genes to Ubiquilin 1 Antibody (H00029979-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquilin 1 Antibody (H00029979-M01PE)

Discover more about diseases related to Ubiquilin 1 Antibody (H00029979-M01PE).
 

Pathways for Ubiquilin 1 Antibody (H00029979-M01PE)

View related products by pathway.

PTMs for Ubiquilin 1 Antibody (H00029979-M01PE)

Learn more about PTMs related to Ubiquilin 1 Antibody (H00029979-M01PE).

Blogs on Ubiquilin 1

There are no specific blogs for Ubiquilin 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ubiquilin 1 Antibody (1C6-A3) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol UBQLN1
Entrez