UBE4B Antibody

Images

 
Western Blot: UBE4B Antibody [NBP1-54398] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related UBE4B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54398
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UBE4B Antibody Summary

Immunogen
Synthetic peptides corresponding to UBE4B(ubiquitination factor E4B (UFD2 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE4B. Peptide sequence SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL.
Clonality
Polyclonal
Host
Rabbit
Gene
UBE4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UBE4B and was validated on Western blot.
Theoretical MW
146 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UBE4B Antibody

  • E4
  • homologous to yeast UFD2
  • Homozygously deleted in neuroblastoma 1
  • homozygously deleted in neuroblastoma-1
  • KIAA0684HDNB1
  • ubiquitin conjugation factor E4 B
  • Ubiquitin fusion degradation protein 2
  • ubiquitination factor E4B (homologous to yeast UFD2)
  • ubiquitination factor E4B (UFD2 homolog, yeast)
  • ubiquitin-fusion degradation protein 2
  • UBOX3
  • UFD2UFD2A

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-54398
Species: Hu
Applications: WB

Publications for UBE4B Antibody (NBP1-54398) (0)

There are no publications for UBE4B Antibody (NBP1-54398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE4B Antibody (NBP1-54398) (0)

There are no reviews for UBE4B Antibody (NBP1-54398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE4B Antibody (NBP1-54398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE4B Products

Bioinformatics Tool for UBE4B Antibody (NBP1-54398)

Discover related pathways, diseases and genes to UBE4B Antibody (NBP1-54398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE4B Antibody (NBP1-54398)

Discover more about diseases related to UBE4B Antibody (NBP1-54398).
 

Pathways for UBE4B Antibody (NBP1-54398)

View related products by pathway.

PTMs for UBE4B Antibody (NBP1-54398)

Learn more about PTMs related to UBE4B Antibody (NBP1-54398).
 

Research Areas for UBE4B Antibody (NBP1-54398)

Find related products by research area.

Blogs on UBE4B

There are no specific blogs for UBE4B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE4B
Uniprot