UBE2W Antibody

Images

 
Western Blot: UBE2W Antibody [NBP1-92558] - Analysis in control (vector only transfected HEK293T lysate) and UBE2W over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: UBE2W Antibody [NBP1-92558] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: UBE2W Antibody [NBP1-92558] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE2W Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2W
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UBE2W Protein (NBP1-92558PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2W Antibody

  • EC 6.3.2.19
  • FLJ11011
  • hUBC-16
  • probable ubiquitin-conjugating enzyme E2 W
  • Ubc16
  • UBE2W
  • Ubiquitin carrier protein W
  • ubiquitin-conjugating enzyme 16
  • ubiquitin-conjugating enzyme E2W (putative)
  • Ubiquitin-protein ligase W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02965
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
H00055120-D01P
Species: Hu
Applications: WB, ICC/IF
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP2-92000
Species: Hu, Mu, Rt
Applications: WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75440
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-80461
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-404
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-319
Species: Hu
Applications: WB, IP
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA

Publications for UBE2W Antibody (NBP1-92558) (0)

There are no publications for UBE2W Antibody (NBP1-92558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2W Antibody (NBP1-92558) (0)

There are no reviews for UBE2W Antibody (NBP1-92558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2W Antibody (NBP1-92558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBE2W Products

Bioinformatics Tool for UBE2W Antibody (NBP1-92558)

Discover related pathways, diseases and genes to UBE2W Antibody (NBP1-92558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2W Antibody (NBP1-92558)

Discover more about diseases related to UBE2W Antibody (NBP1-92558).
 

Pathways for UBE2W Antibody (NBP1-92558)

View related products by pathway.

PTMs for UBE2W Antibody (NBP1-92558)

Learn more about PTMs related to UBE2W Antibody (NBP1-92558).

Blogs on UBE2W

There are no specific blogs for UBE2W, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2W Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2W