UBE2N/Ubc13 Antibody (4C11-G11)

Images

 
Sandwich ELISA: UBE2N/Ubc13 Antibody (4C11-G11) [H00007334-M01] - Detection limit for recombinant GST tagged UBE2N is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C11-G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBE2N/Ubc13 Antibody (4C11-G11) Summary

Immunogen
UBE2N (AAH03365, 1 a.a. - 152 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Localization
Nuclear
Specificity
UBE2N - ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2N
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 4
using
H00007334-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2N/Ubc13 Antibody (4C11-G11)

  • bendless-like ubiquitin conjugating enzyme
  • Bendless-like ubiquitin-conjugating enzyme
  • BLU
  • EC 6.3.2.19
  • MGC131857
  • MGC8489
  • UBC13
  • UbcH13
  • UbcH-ben
  • UBE2N
  • Ubiquitin carrier protein N
  • ubiquitin-conjugating enzyme E2 N
  • ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
  • ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
  • Ubiquitin-protein ligase N
  • yeast UBC13 homolog

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56360
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56397
Species: Hu
Applications: WB
NBP2-26506
Species: Hu, Mu, Rt
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-56363
Species: Hu, Mu
Applications: WB
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UBE2N/Ubc13 Antibody (H00007334-M01) (0)

There are no publications for UBE2N/Ubc13 Antibody (H00007334-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for UBE2N/Ubc13 Antibody (H00007334-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00007334-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UBE2N/Ubc13 H00007334-M01
Enlarge
reviewed by:
Anonymous
WB Human 08/30/2016
View

Summary

ApplicationWestern Blot
Sample Tested293 whole cell lysate
SpeciesHuman
Lot08081-S1

Blocking

Blocking Details5% skim milk in TBS

Details

Detection NotesECL

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2N/Ubc13 Antibody (H00007334-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2N/Ubc13 Products

Bioinformatics Tool for UBE2N/Ubc13 Antibody (H00007334-M01)

Discover related pathways, diseases and genes to UBE2N/Ubc13 Antibody (H00007334-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2N/Ubc13 Antibody (H00007334-M01)

Discover more about diseases related to UBE2N/Ubc13 Antibody (H00007334-M01).
 

Pathways for UBE2N/Ubc13 Antibody (H00007334-M01)

View related products by pathway.

PTMs for UBE2N/Ubc13 Antibody (H00007334-M01)

Learn more about PTMs related to UBE2N/Ubc13 Antibody (H00007334-M01).
 

Research Areas for UBE2N/Ubc13 Antibody (H00007334-M01)

Find related products by research area.

Blogs on UBE2N/Ubc13

There are no specific blogs for UBE2N/Ubc13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/30/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol UBE2N
Entrez
OMIM
Uniprot