UBE2M/Ubc12 Antibody (3C4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related UBE2M/Ubc12 Primary Antibodies

Order Details


    • Catalog Number
      H00009040-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UBE2M/Ubc12 Antibody (3C4) [DyLight 488] Summary

Immunogen
UBE2M (AAH58924, 1 a.a. - 183 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Specificity
UBE2M - ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2M
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2M/Ubc12 Antibody (3C4) [DyLight 488]

  • EC 6.3.2
  • EC 6.3.2.-
  • hUbc12
  • NEDD8 carrier protein
  • NEDD8 protein ligase
  • UBC12
  • UBC12NEDD8-conjugating enzyme Ubc12
  • UbcH12
  • UBC-RS2
  • UBE2M
  • ubiquitin carrier protein M
  • Ubiquitin-conjugating enzyme E2 M
  • ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12)
  • ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
  • ubiquitin-protein ligase M
  • yeast UBC12 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP2-49443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00054165-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-2267
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009040-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for UBE2M/Ubc12 Antibody (H00009040-M01G) (0)

There are no publications for UBE2M/Ubc12 Antibody (H00009040-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2M/Ubc12 Antibody (H00009040-M01G) (0)

There are no reviews for UBE2M/Ubc12 Antibody (H00009040-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2M/Ubc12 Antibody (H00009040-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2M/Ubc12 Products

Bioinformatics Tool for UBE2M/Ubc12 Antibody (H00009040-M01G)

Discover related pathways, diseases and genes to UBE2M/Ubc12 Antibody (H00009040-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2M/Ubc12 Antibody (H00009040-M01G)

Discover more about diseases related to UBE2M/Ubc12 Antibody (H00009040-M01G).
 

Pathways for UBE2M/Ubc12 Antibody (H00009040-M01G)

View related products by pathway.

Blogs on UBE2M/Ubc12

There are no specific blogs for UBE2M/Ubc12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2M/Ubc12 Antibody (3C4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2M
Entrez