UBE2G1 Antibody (1C12-1B2) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related UBE2G1 Primary Antibodies

Order Details


    • Catalog Number
      H00007326-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UBE2G1 Antibody (1C12-1B2) [PerCP] Summary

Immunogen
UBE2G1 (AAH02775, 1 a.a. - 170 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Specificity
UBE2G1 - ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2G1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2G1 Antibody (1C12-1B2) [PerCP]

  • E217K
  • EC 6.3.2.19
  • UBC7
  • UBE2G1
  • UBE2GE217K
  • Ubiquitin carrier protein G1
  • ubiquitin-conjugating enzyme E2 G1
  • ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7)
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
  • Ubiquitin-protein ligase G1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NBP2-46270
Species: Hu
Applications: WB, IHC
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-30367
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
E2-616
Species: Hu

Publications for UBE2G1 Antibody (H00007326-M01PCP) (0)

There are no publications for UBE2G1 Antibody (H00007326-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2G1 Antibody (H00007326-M01PCP) (0)

There are no reviews for UBE2G1 Antibody (H00007326-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2G1 Antibody (H00007326-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2G1 Products

Bioinformatics Tool for UBE2G1 Antibody (H00007326-M01PCP)

Discover related pathways, diseases and genes to UBE2G1 Antibody (H00007326-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2G1 Antibody (H00007326-M01PCP)

Discover more about diseases related to UBE2G1 Antibody (H00007326-M01PCP).
 

Pathways for UBE2G1 Antibody (H00007326-M01PCP)

View related products by pathway.

Research Areas for UBE2G1 Antibody (H00007326-M01PCP)

Find related products by research area.

Blogs on UBE2G1

There are no specific blogs for UBE2G1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2G1 Antibody (1C12-1B2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2G1
Entrez