UBE2E2 Antibody (4B4) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related UBE2E2 Primary Antibodies

Order Details


    • Catalog Number
      H00007325-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UBE2E2 Antibody (4B4) [DyLight 680] Summary

Immunogen
UBE2E2 (AAH22332, 1 a.a. - 201 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Specificity
UBE2E2 - ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2E2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2E2 Antibody (4B4) [DyLight 680]

  • EC 6.3.2.19
  • FLJ25157
  • UBCH8
  • Ubiquitin carrier protein E2
  • ubiquitin-conjugating enzyme E2 E2
  • ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5)
  • ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
  • Ubiquitin-protein ligase E2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
A-306
Species: Hu
Applications: WB, IHC
NBP1-78983
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03819
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
E2-616
Species: Hu
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-87989
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-55039
Species: Hu
Applications: WB

Publications for UBE2E2 Antibody (H00007325-M01FR) (0)

There are no publications for UBE2E2 Antibody (H00007325-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2E2 Antibody (H00007325-M01FR) (0)

There are no reviews for UBE2E2 Antibody (H00007325-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2E2 Antibody (H00007325-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2E2 Products

Bioinformatics Tool for UBE2E2 Antibody (H00007325-M01FR)

Discover related pathways, diseases and genes to UBE2E2 Antibody (H00007325-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2E2 Antibody (H00007325-M01FR)

Discover more about diseases related to UBE2E2 Antibody (H00007325-M01FR).
 

Pathways for UBE2E2 Antibody (H00007325-M01FR)

View related products by pathway.

PTMs for UBE2E2 Antibody (H00007325-M01FR)

Learn more about PTMs related to UBE2E2 Antibody (H00007325-M01FR).

Blogs on UBE2E2

There are no specific blogs for UBE2E2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2E2 Antibody (4B4) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2E2