UbcH7/UBE2L3 Antibody

Images

 
Western Blot: UbcH7/UBE2L3 Antibody [NBP1-52983] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: UbcH7/UBE2L3 Antibody [NBP1-52983] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X ...read more

Product Details

Summary
Product Discontinued
View other related UbcH7/UBE2L3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52983
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UbcH7/UBE2L3 Antibody Summary

Immunogen
Synthetic peptides corresponding to UBE2L3(ubiquitin-conjugating enzyme E2L 3) The peptide sequence was selected from the C terminal of UBE2L3. Peptide sequence TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK.
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2L3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against UBE2L3 and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UbcH7/UBE2L3 Antibody

  • E2-F1
  • EC 6.3.2.19
  • L-UBC
  • UBCE7
  • UbcH7
  • UBCH7UbcM4
  • UbcM4
  • UBE2L3
  • Ubiquitin carrier protein L3
  • ubiquitin-conjugating enzyme E2 L3
  • Ubiquitin-conjugating enzyme E2-F1
  • ubiquitin-conjugating enzyme E2L 3
  • ubiquitin-conjugating enzyme UBCH7
  • Ubiquitin-protein ligase L3

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacteylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
NB500-240
Species: Hu, Mu
Applications: WB, IP
E2-616
Species: Hu
NBP1-92556
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-55039
Species: Hu
Applications: WB
NBP2-46270
Species: Hu
Applications: WB, IHC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for UbcH7/UBE2L3 Antibody (NBP1-52983) (0)

There are no publications for UbcH7/UBE2L3 Antibody (NBP1-52983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UbcH7/UBE2L3 Antibody (NBP1-52983) (0)

There are no reviews for UbcH7/UBE2L3 Antibody (NBP1-52983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UbcH7/UBE2L3 Antibody (NBP1-52983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UbcH7/UBE2L3 Products

Bioinformatics Tool for UbcH7/UBE2L3 Antibody (NBP1-52983)

Discover related pathways, diseases and genes to UbcH7/UBE2L3 Antibody (NBP1-52983). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH7/UBE2L3 Antibody (NBP1-52983)

Discover more about diseases related to UbcH7/UBE2L3 Antibody (NBP1-52983).
 

Pathways for UbcH7/UBE2L3 Antibody (NBP1-52983)

View related products by pathway.

PTMs for UbcH7/UBE2L3 Antibody (NBP1-52983)

Learn more about PTMs related to UbcH7/UBE2L3 Antibody (NBP1-52983).
 

Research Areas for UbcH7/UBE2L3 Antibody (NBP1-52983)

Find related products by research area.

Blogs on UbcH7/UBE2L3

There are no specific blogs for UbcH7/UBE2L3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH7/UBE2L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2L3
Entrez
Uniprot