UbcH2/UBE2H Antibody (3C4-1A2) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related UbcH2/UBE2H Primary Antibodies

Order Details


    • Catalog Number
      H00007328-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UbcH2/UBE2H Antibody (3C4-1A2) [DyLight 680] Summary

Immunogen
UBE2H (AAH06277, 1 a.a. - 183 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Specificity
UBE2H - ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UbcH2/UBE2H Antibody (3C4-1A2) [DyLight 680]

  • E2-14K
  • E2-20K
  • EC 6.3.2.19
  • UBC8
  • UBC8E2-20K
  • UBCH
  • UbcH2
  • UBE2H
  • Ubiquitin carrier protein H
  • ubiquitin-conjugating enzyme E2 H
  • Ubiquitin-conjugating enzyme E2-20K
  • ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8)
  • ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
  • Ubiquitin-protein ligase H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
E2-616
Species: Hu
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-46270
Species: Hu
Applications: WB, IHC
E2-695
Species: Hu
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
E2-627
Species: Hu
NBP1-84891
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UbcH2/UBE2H Antibody (H00007328-M01FR) (0)

There are no publications for UbcH2/UBE2H Antibody (H00007328-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UbcH2/UBE2H Antibody (H00007328-M01FR) (0)

There are no reviews for UbcH2/UBE2H Antibody (H00007328-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UbcH2/UBE2H Antibody (H00007328-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UbcH2/UBE2H Products

Bioinformatics Tool for UbcH2/UBE2H Antibody (H00007328-M01FR)

Discover related pathways, diseases and genes to UbcH2/UBE2H Antibody (H00007328-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH2/UBE2H Antibody (H00007328-M01FR)

Discover more about diseases related to UbcH2/UBE2H Antibody (H00007328-M01FR).
 

Pathways for UbcH2/UBE2H Antibody (H00007328-M01FR)

View related products by pathway.

PTMs for UbcH2/UBE2H Antibody (H00007328-M01FR)

Learn more about PTMs related to UbcH2/UBE2H Antibody (H00007328-M01FR).

Blogs on UbcH2/UBE2H

There are no specific blogs for UbcH2/UBE2H, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH2/UBE2H Antibody (3C4-1A2) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2H
Entrez