UbcH10/UBE2C Antibody

Images

 
Western Blot: UBE2C Antibody [NBP1-58164] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related UbcH10/UBE2C Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58164
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UbcH10/UBE2C Antibody Summary

Immunogen
Synthetic peptides corresponding to UBE2C (ubiquitin-conjugating enzyme E2C) The peptide sequence was selected from the middle region of UBE2C. Peptide sequence GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UBE2C and was validated on Western blot.
Control
UbcH10/UBE2C Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UbcH10/UBE2C Antibody

  • cyclin-selective ubiquitin carrier protein
  • dJ447F3.2
  • EC 6.3.2.19
  • UbcH10
  • UBCH10mitotic-specific ubiquitin-conjugating enzyme
  • UBE2C
  • Ubiquitin carrier protein C
  • ubiquitin carrier protein E2-C
  • ubiquitin-conjugating enzyme E2 C
  • ubiquitin-conjugating enzyme E2C
  • Ubiquitin-protein ligase C

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, IHC-P, IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
E2-622
Species: Hu
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
E2-616
Species: Hu
NBP2-75659
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
E2-690
Species: Hu
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
E2-627
Species: Hu
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UbcH10/UBE2C Antibody (NBP1-58164) (0)

There are no publications for UbcH10/UBE2C Antibody (NBP1-58164).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UbcH10/UBE2C Antibody (NBP1-58164) (0)

There are no reviews for UbcH10/UBE2C Antibody (NBP1-58164). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UbcH10/UBE2C Antibody (NBP1-58164) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UbcH10/UBE2C Products

Bioinformatics Tool for UbcH10/UBE2C Antibody (NBP1-58164)

Discover related pathways, diseases and genes to UbcH10/UBE2C Antibody (NBP1-58164). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH10/UBE2C Antibody (NBP1-58164)

Discover more about diseases related to UbcH10/UBE2C Antibody (NBP1-58164).
 

Pathways for UbcH10/UBE2C Antibody (NBP1-58164)

View related products by pathway.

PTMs for UbcH10/UBE2C Antibody (NBP1-58164)

Learn more about PTMs related to UbcH10/UBE2C Antibody (NBP1-58164).
 

Research Areas for UbcH10/UBE2C Antibody (NBP1-58164)

Find related products by research area.

Blogs on UbcH10/UBE2C

There are no specific blogs for UbcH10/UBE2C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH10/UBE2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2C