UAP1 Antibody

Images

 
Western Blot: UAP1 Antibody [NBP1-74222] - Mouse Brain Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Product Discontinued
View other related UAP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74222
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UAP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Uap1. Immunizing peptide sequence LKDANDVPIQCEISPLISYAGEGLEGYVADKEFHAPLIIDENGVHELVKN.
Clonality
Polyclonal
Host
Rabbit
Gene
UAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Uap1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UAP1 Antibody

  • AGX
  • AGX1
  • AGX2
  • Antigen X
  • EC 2.7.7
  • EC 2.7.7.23
  • EC 2.7.7.27
  • SPAG2
  • sperm associated antigen 2
  • Sperm-associated antigen 2
  • UDP-N-acetylhexosamine pyrophosphorylase
  • UDP-N-acteylglucosamine pyrophosphorylase 1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32210
Species: Hu
Applications: WB, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF4600
Species: Mu
Applications: WB, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83842
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
H00023169-R01
Species: Hu
NBP2-38040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for UAP1 Antibody (NBP1-74222) (0)

There are no publications for UAP1 Antibody (NBP1-74222).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UAP1 Antibody (NBP1-74222) (0)

There are no reviews for UAP1 Antibody (NBP1-74222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UAP1 Antibody (NBP1-74222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UAP1 Products

Bioinformatics Tool for UAP1 Antibody (NBP1-74222)

Discover related pathways, diseases and genes to UAP1 Antibody (NBP1-74222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UAP1

There are no specific blogs for UAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UAP1