u-Plasminogen Activator/Urokinase Antibody (3B8)

Images

 
Sandwich ELISA: u-Plasminogen Activator/Urokinase Antibody (3B8) [H00005328-M01] - Detection limit for recombinant GST tagged PLAU is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

u-Plasminogen Activator/Urokinase Antibody (3B8) Summary

Immunogen
PLAU (AAH13575, 16 a.a. - 115 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLG
Specificity
PLAU - plasminogen activator, urokinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLAU
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for u-Plasminogen Activator/Urokinase Antibody (3B8)

  • ATF
  • EC 3.4.21
  • EC 3.4.21.73
  • plasminogen activator, urokinase
  • PLAU
  • uPA
  • u-PA
  • uPlasminogen Activator
  • u-Plasminogen Activator
  • urinary
  • Urokinase
  • urokinase-type plasminogen activator

Background

This gene encodes a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in this gene may be associated with late-onset Alzheimer disease and also with decreased affinity for fibrin-binding. The protein encoded by this gene converts plasminogen to plasmin by specific cleavage of an Arg-Val bond in plasminogen. This gene's proprotein is cleaved at a Lys-Ile bond by plasmin to form a two-chain derivative in which a single disulfide bond connects the amino-terminal A-chain to the catalytically active, carboxy-terminal B-chain. This two-chain derivative is also called HMW-uPA (high molecular weight uPA). HMW-uPA can be further processed into LMW-uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino-terminal fragment. LMW-uPA is proteolytically active but does not bind to the uPA receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP2-07799
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00005328-M01
Species: Hu
Applications: WB, ELISA

Publications for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01) (0)

There are no publications for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01) (0)

There are no reviews for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional u-Plasminogen Activator/Urokinase Products

Bioinformatics Tool for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01)

Discover related pathways, diseases and genes to u-Plasminogen Activator/Urokinase Antibody (H00005328-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01)

Discover more about diseases related to u-Plasminogen Activator/Urokinase Antibody (H00005328-M01).
 

Pathways for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01)

View related products by pathway.

PTMs for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01)

Learn more about PTMs related to u-Plasminogen Activator/Urokinase Antibody (H00005328-M01).
 

Research Areas for u-Plasminogen Activator/Urokinase Antibody (H00005328-M01)

Find related products by research area.

Blogs on u-Plasminogen Activator/Urokinase

There are no specific blogs for u-Plasminogen Activator/Urokinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our u-Plasminogen Activator/Urokinase Antibody (3B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAU
Entrez
OMIM
Uniprot