TXNL2 Antibody (4B5-2A8)

Images

 
Western Blot: TXNL2 Antibody (4B5-2A8) [H00010539-M01] - GLRX3 monoclonal antibody (M01), clone 4B5-2A8 Analysis of GLRX3 expression in Hela.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B5-2A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TXNL2 Antibody (4B5-2A8) Summary

Immunogen
TXNL2 (AAH05289, 1 a.a. ~ 336 a.a) full length recombinant protein with GST tag.MAKSENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLG DDGKCGEEAAAGLGEEGENGEDTAAGSGEDGKKGGDTDEDSE ADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLE SKFLREFHDIERKFAEMYQPLLEKRRQIINAIYEPTEEECEY KSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDY AVEEEEEEEEEDDIEATGEENKEEEDPKGIPDFWL
Specificity
TXNL2 - thioredoxin-like 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLRX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00010539-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TXNL2 Antibody (4B5-2A8)

  • FLJ11864
  • GLRX4
  • glutaredoxin 3
  • glutaredoxin 4
  • glutaredoxin-3
  • GRX3
  • GRX4
  • PICOTbA500G10.4
  • PKC-interacting cousin of thioredoxin
  • PKCq-interacting protein
  • PKC-theta-interacting protein
  • thioredoxin-like 2
  • Thioredoxin-like protein 2
  • TXNL2
  • TXNL3

Background

May play a role in regulating the function of the thioredoxin system. Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3119
Species: Mu
Applications: WB
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48719
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14003
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4368
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-89096
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00010539-M01
Species: Hu
Applications: WB, ELISA

Publications for TXNL2 Antibody (H00010539-M01)(1)

Reviews for TXNL2 Antibody (H00010539-M01) (0)

There are no reviews for TXNL2 Antibody (H00010539-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNL2 Antibody (H00010539-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNL2 Products

Bioinformatics Tool for TXNL2 Antibody (H00010539-M01)

Discover related pathways, diseases and genes to TXNL2 Antibody (H00010539-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNL2 Antibody (H00010539-M01)

Discover more about diseases related to TXNL2 Antibody (H00010539-M01).
 

Pathways for TXNL2 Antibody (H00010539-M01)

View related products by pathway.

PTMs for TXNL2 Antibody (H00010539-M01)

Learn more about PTMs related to TXNL2 Antibody (H00010539-M01).

Blogs on TXNL2

There are no specific blogs for TXNL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNL2 Antibody (4B5-2A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRX3
Entrez
Uniprot