Twist-1 Antibody (9E390)

Images

 
Western Blot: Twist-1 Antibody (3E11) [H00007291-M01] - TWIST1 monoclonal antibody (M01), clone 3E11. Analysis of TWIST1 expression in rat testis.
Western Blot: Twist-1 Antibody (3E11) [H00007291-M01] - Western Blot analysis in rat brain.
Western Blot: Twist-1 Antibody (3E11) [H00007291-M01] - Analysis of TWIST1 over-expressed 293 cell line, cotransfected with TWIST1 Validated Chimera RNAi ( Cat # H00007291-R01V ) (Lane 2) or non-transfected control ...read more
Western Blot: Twist-1 Antibody (3E11) [H00007291-M01] - Analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody (M01), clone 3E11.Lane 1: TWIST1 transfected lysate(21 KDa).Lane 2: ...read more
Immunoprecipitation: Twist-1 Antibody (3E11) [H00007291-M01] - Analysis of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST1 MaxPab rabbit ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, RNAi
Clone
9E390
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Twist-1 Antibody (9E390) Summary

Immunogen
TWIST1 (NP_000465, 100 a.a. - 202 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
Specificity
TWIST1 - twist homolog 1 (acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TWIST1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • RNA Inhibition
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 25002532).
Publications
Read Publications using H00007291-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Twist-1 Antibody (9E390)

  • acrocephalosyndactyly 3
  • ACS3
  • B-HLH DNA binding protein
  • BHLHA38
  • bHLHa38BPES3
  • BPES3
  • Class A basic helix-loop-helix protein 38
  • CRS1
  • H-twist
  • H-twistblepharophimosis, epicanthus inversus and ptosis 3
  • SCSBPES2
  • twist homolog 1 (Drosophila)
  • TWIST homolog of drosophila
  • TWIST
  • Twist1
  • Twist-1
  • twist-related protein 1

Background

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00117581-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-27293
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-66840
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, Single Cell Western
H00007291-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IP, RNAi

Publications for Twist-1 Antibody (H00007291-M01)(3)

Reviews for Twist-1 Antibody (H00007291-M01) (0)

There are no reviews for Twist-1 Antibody (H00007291-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Twist-1 Antibody (H00007291-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Twist-1 Antibody (H00007291-M01)

Discover related pathways, diseases and genes to Twist-1 Antibody (H00007291-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Twist-1 Antibody (H00007291-M01)

Discover more about diseases related to Twist-1 Antibody (H00007291-M01).
 

Pathways for Twist-1 Antibody (H00007291-M01)

View related products by pathway.

PTMs for Twist-1 Antibody (H00007291-M01)

Learn more about PTMs related to Twist-1 Antibody (H00007291-M01).
 

Research Areas for Twist-1 Antibody (H00007291-M01)

Find related products by research area.

Blogs on Twist-1.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Twist-1 Antibody (9E390) and receive a gift card or discount.

Bioinformatics

Gene Symbol TWIST1
Entrez
OMIM
Uniprot