TULP2 Antibody (2B5) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related TULP2 Primary Antibodies

Order Details


    • Catalog Number
      H00007288-M03G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TULP2 Antibody (2B5) [DyLight 488] Summary

Immunogen
TULP2 (NP_003314 141 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDS
Specificity
TULP2 - tubby like protein 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TULP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TULP2 Antibody (2B5) [DyLight 488]

  • Cancer/testis antigen 65
  • CT65cancer testis antigen 65
  • tubby like protein 2
  • Tubby-like protein 2
  • TUBL2tubby-related protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20758
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01671
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88505
Species: Hu
Applications: IHC, IHC-P
H00064396-P01
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
H00007288-M03G
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for TULP2 Antibody (H00007288-M03G) (0)

There are no publications for TULP2 Antibody (H00007288-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TULP2 Antibody (H00007288-M03G) (0)

There are no reviews for TULP2 Antibody (H00007288-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TULP2 Antibody (H00007288-M03G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TULP2 Products

Bioinformatics Tool for TULP2 Antibody (H00007288-M03G)

Discover related pathways, diseases and genes to TULP2 Antibody (H00007288-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TULP2 Antibody (H00007288-M03G)

Discover more about diseases related to TULP2 Antibody (H00007288-M03G).
 

Pathways for TULP2 Antibody (H00007288-M03G)

View related products by pathway.

Research Areas for TULP2 Antibody (H00007288-M03G)

Find related products by research area.

Blogs on TULP2.

Can Tubby Make You Tubby?
The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TULP2 Antibody (2B5) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol TULP2