TUBB8 Antibody

Images

 
Western Blot: TUBB8 Antibody [NBP2-13494] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: TUBB8 Antibody [NBP2-13494] - Staining of human cerebral cortex shows neuropil positivity.
Western Blot: TUBB8 Antibody [NBP2-13494] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TUBB8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SILPSPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBB8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TUBB8 Protein (NBP2-13494PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TUBB8 Antibody

  • tubulin beta-8 chain
  • bA631M21.2
  • RP11-631M21.2
  • tubulin, beta 8 class VIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TUBB8 Antibody (NBP2-13494) (0)

There are no publications for TUBB8 Antibody (NBP2-13494).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUBB8 Antibody (NBP2-13494) (0)

There are no reviews for TUBB8 Antibody (NBP2-13494). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TUBB8 Antibody (NBP2-13494). (Showing 1 - 1 of 1 FAQ).

  1. What is the concentration of lot No. R4225 of this antibody?
    • I can confirm that lot number R42285 is at 0.1mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional TUBB8 Products

Bioinformatics Tool for TUBB8 Antibody (NBP2-13494)

Discover related pathways, diseases and genes to TUBB8 Antibody (NBP2-13494). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for TUBB8 Antibody (NBP2-13494)

Find related products by research area.

Blogs on TUBB8

There are no specific blogs for TUBB8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUBB8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBB8