TTF1 / NKX2.1 Antibody (1G2)

Images

 
There are currently no images for TTF1 / NKX2.1 Antibody (H00007080-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TTF1 / NKX2.1 Antibody (1G2) Summary

Immunogen
TITF1 (NP_003308 77 a.a. - 158 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPS
Specificity
TITF1 (1G2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NKX2-1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTF1 / NKX2.1 Antibody (1G2)

  • BCH
  • benign chorea
  • BHC
  • Homeobox protein NK-2 homolog A
  • homeobox protein Nkx-2.1
  • NK2 homeobox 1
  • NK-2 homolog A
  • NKX2.1
  • NKX2-1
  • NKX2A
  • NKX2ANKX2.1
  • T/EBP
  • Thyroid nuclear factor 1
  • Thyroid transcription factor 1BHC
  • TITF1
  • TITF1TEBP
  • TTF1
  • TTF-1
  • TTF1BCH
  • TTF-1NK-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-32440
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4218
Species: Hu
Applications: WB, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
MAB6534
Species: Hu
Applications: WB, ELISA
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-45677
Species: Hu, Mk
Applications: WB, IHC

Publications for TTF1 / NKX2.1 Antibody (H00007080-M02) (0)

There are no publications for TTF1 / NKX2.1 Antibody (H00007080-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTF1 / NKX2.1 Antibody (H00007080-M02) (0)

There are no reviews for TTF1 / NKX2.1 Antibody (H00007080-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTF1 / NKX2.1 Antibody (H00007080-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTF1 / NKX2.1 Products

Bioinformatics Tool for TTF1 / NKX2.1 Antibody (H00007080-M02)

Discover related pathways, diseases and genes to TTF1 / NKX2.1 Antibody (H00007080-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTF1 / NKX2.1 Antibody (H00007080-M02)

Discover more about diseases related to TTF1 / NKX2.1 Antibody (H00007080-M02).
 

Pathways for TTF1 / NKX2.1 Antibody (H00007080-M02)

View related products by pathway.

PTMs for TTF1 / NKX2.1 Antibody (H00007080-M02)

Learn more about PTMs related to TTF1 / NKX2.1 Antibody (H00007080-M02).

Blogs on TTF1 / NKX2.1.

TTF1 / NKX2.1 - An essential regulator of lung development with implications in cancer diagnostics
Thyroid transcription factor 1 (TTF-1), also known as NKX2.1, is a conserved master regulatory transcription factor involved in the development of the lung, brain, and thyroid (1). In the lung TTF-1 positively regulates the expression of several lu...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTF1 / NKX2.1 Antibody (1G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-1
Entrez
OMIM
Uniprot