TTF1 / NKX2.1 Antibody (1G2)


There are currently no images for TTF1 / NKX2.1 Antibody (H00007080-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA

Order Details

TTF1 / NKX2.1 Antibody (1G2) Summary

TITF1 (NP_003308 77 a.a. - 158 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPS
TITF1 (1G2)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTF1 / NKX2.1 Antibody (1G2)

  • BCH
  • benign chorea
  • BHC
  • Homeobox protein NK-2 homolog A
  • homeobox protein Nkx-2.1
  • NK2 homeobox 1
  • NK-2 homolog A
  • NKX2.1
  • NKX2-1
  • NKX2A
  • NKX2ANKX2.1
  • T/EBP
  • Thyroid nuclear factor 1
  • Thyroid transcription factor 1BHC
  • TITF1
  • TTF1
  • TTF-1
  • TTF-1NK-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, Single Cell Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mk
Applications: WB, IHC

Publications for TTF1 / NKX2.1 Antibody (H00007080-M02) (0)

There are no publications for TTF1 / NKX2.1 Antibody (H00007080-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTF1 / NKX2.1 Antibody (H00007080-M02) (0)

There are no reviews for TTF1 / NKX2.1 Antibody (H00007080-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTF1 / NKX2.1 Antibody (H00007080-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TTF1 / NKX2.1 Products

Bioinformatics Tool for TTF1 / NKX2.1 Antibody (H00007080-M02)

Discover related pathways, diseases and genes to TTF1 / NKX2.1 Antibody (H00007080-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTF1 / NKX2.1 Antibody (H00007080-M02)

Discover more about diseases related to TTF1 / NKX2.1 Antibody (H00007080-M02).

Pathways for TTF1 / NKX2.1 Antibody (H00007080-M02)

View related products by pathway.

PTMs for TTF1 / NKX2.1 Antibody (H00007080-M02)

Learn more about PTMs related to TTF1 / NKX2.1 Antibody (H00007080-M02).

Blogs on TTF1 / NKX2.1.

TTF1 / NKX2.1 - An essential regulator of lung development with implications in cancer diagnostics
Thyroid transcription factor 1 (TTF-1), also known as NKX2.1, is a conserved master regulatory transcription factor involved in the development of the lung, brain, and thyroid (1). In the lung TTF-1 positively regulates the expression of several lu...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTF1 / NKX2.1 Antibody (1G2) and receive a gift card or discount.


Gene Symbol NKX2-1