TTC8 Antibody

Images

 
Immunohistochemistry-Paraffin: TTC8 Antibody [NBP1-88688] - Staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.

Product Details

Summary
Product Discontinued
View other related TTC8 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88688
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TTC8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQMLEKSPYDQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAI
Specificity
Specificity of human TTC8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publications using
NBP1-88688 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23943788).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC8 Antibody

  • Bardet-Biedl syndrome 8 protein
  • BBS8Bardet-Biedl syndrome type 8
  • RP51
  • tetratricopeptide repeat domain 8
  • tetratricopeptide repeat protein 8
  • TPR repeat protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52654
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80848
Species: Hu
Applications: IHC, IHC-P
20760002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-60661
Species: Hu
Applications: WB, IP
NBP1-88688
Species: Hu, Mu, Mu, Rt
Applications: IHC, IHC-P

Publications for TTC8 Antibody (NBP1-88688)(4)

Reviews for TTC8 Antibody (NBP1-88688) (0)

There are no reviews for TTC8 Antibody (NBP1-88688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTC8 Antibody (NBP1-88688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TTC8 Antibody (NBP1-88688)

Discover related pathways, diseases and genes to TTC8 Antibody (NBP1-88688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC8 Antibody (NBP1-88688)

Discover more about diseases related to TTC8 Antibody (NBP1-88688).
 

Pathways for TTC8 Antibody (NBP1-88688)

View related products by pathway.

Research Areas for TTC8 Antibody (NBP1-88688)

Find related products by research area.

Blogs on TTC8

There are no specific blogs for TTC8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC8