Recombinant Human TTC35 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TTC35 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-297 of Human TTC35 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS

Protein/Peptide Type
Recombinant Protein
Gene
EMC2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TTC35 Protein

  • KIAA0103TPR repeat protein 35
  • tetratricopeptide repeat domain 35
  • tetratricopeptide repeat protein 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20174
Species: Hu, Mu
Applications: WB, ICC/IF
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-92269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA

Publications for TTC35 Recombinant Protein (H00009694-P01) (0)

There are no publications for TTC35 Recombinant Protein (H00009694-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC35 Recombinant Protein (H00009694-P01) (0)

There are no reviews for TTC35 Recombinant Protein (H00009694-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC35 Recombinant Protein (H00009694-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTC35 Products

Bioinformatics Tool for TTC35 Recombinant Protein (H00009694-P01)

Discover related pathways, diseases and genes to TTC35 Recombinant Protein (H00009694-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC35

There are no specific blogs for TTC35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TPR Antibody
NB100-2866
TTC35 Antibody
NBP2-13490
PRPF3 Antibody
NBP1-83219

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TTC35 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EMC2