TTC35 Antibody

Images

 
Western Blot: TTC35 Antibody [NBP2-13490] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-612
Immunohistochemistry-Paraffin: TTC35 Antibody [NBP2-13490] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC35 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWII YEQVMIAALDYGRDDLALFCLQELRRQFPGSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TTC35 Protein (NBP2-13490PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC35 Antibody

  • KIAA0103TPR repeat protein 35
  • tetratricopeptide repeat domain 35
  • tetratricopeptide repeat protein 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20174
Species: Hu, Mu
Applications: WB, ICC/IF
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-92269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA

Publications for TTC35 Antibody (NBP2-13490) (0)

There are no publications for TTC35 Antibody (NBP2-13490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC35 Antibody (NBP2-13490) (0)

There are no reviews for TTC35 Antibody (NBP2-13490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC35 Antibody (NBP2-13490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC35 Products

Bioinformatics Tool for TTC35 Antibody (NBP2-13490)

Discover related pathways, diseases and genes to TTC35 Antibody (NBP2-13490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC35

There are no specific blogs for TTC35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EMC2