TSSC1 Antibody (2H5) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related TSSC1 Primary Antibodies

Order Details


    • Catalog Number
      H00007260-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TSSC1 Antibody (2H5) [PE] Summary

Immunogen
TSSC1 (NP_003301, 288 a.a. - 387 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL
Specificity
TSSC1 (2H5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSSC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSSC1 Antibody (2H5) [PE]

  • protein TSSC1
  • tumor suppressing subtransferable candidate 1
  • Tumor-suppressing STF cDNA 1 protein
  • Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-36543
Species: Hu
Applications: WB, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-84969
Species: Hu
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
AF5629
Species: Hu, Mu
Applications: WB
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: WB, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-59448
Species: Hu
Applications: WB
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007260-M01PE
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for TSSC1 Antibody (H00007260-M01PE) (0)

There are no publications for TSSC1 Antibody (H00007260-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSSC1 Antibody (H00007260-M01PE) (0)

There are no reviews for TSSC1 Antibody (H00007260-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSSC1 Antibody (H00007260-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSSC1 Products

Bioinformatics Tool for TSSC1 Antibody (H00007260-M01PE)

Discover related pathways, diseases and genes to TSSC1 Antibody (H00007260-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSC1 Antibody (H00007260-M01PE)

Discover more about diseases related to TSSC1 Antibody (H00007260-M01PE).
 

Pathways for TSSC1 Antibody (H00007260-M01PE)

View related products by pathway.

Blogs on TSSC1

There are no specific blogs for TSSC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSC1 Antibody (2H5) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol TSSC1