TSGA10 Antibody

Images

 
Immunohistochemistry: TSGA10 Antibody [NBP2-32676] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSGA10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSGA10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSGA10 Protein (NBP2-32676PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSGA10 Antibody

  • cancer/testis antigen 79
  • CEP4LCT79
  • Testis development protein NYD-SP7
  • testis specific, 10
  • testis-specific gene 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-49265
Species: Hu
Applications: IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
H00058524-R01
Species: Hu
NBP1-90195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13367
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4885
Species: Mu
Applications: WB, IP
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32676
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for TSGA10 Antibody (NBP2-32676) (0)

There are no publications for TSGA10 Antibody (NBP2-32676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSGA10 Antibody (NBP2-32676) (0)

There are no reviews for TSGA10 Antibody (NBP2-32676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TSGA10 Antibody (NBP2-32676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSGA10 Products

Bioinformatics Tool for TSGA10 Antibody (NBP2-32676)

Discover related pathways, diseases and genes to TSGA10 Antibody (NBP2-32676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSGA10 Antibody (NBP2-32676)

Discover more about diseases related to TSGA10 Antibody (NBP2-32676).
 

Pathways for TSGA10 Antibody (NBP2-32676)

View related products by pathway.

Blogs on TSGA10

There are no specific blogs for TSGA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSGA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSGA10