TSG101 Antibody (5B7) [DyLight 755]

Images

 

Product Details

Summary
Product Discontinued
View other related TSG101 Primary Antibodies

Order Details


    • Catalog Number
      H00007251-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TSG101 Antibody (5B7) [DyLight 755] Summary

Immunogen
TSG101 (NP_006283 201 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE
Localization
Mainly cytoplasmic. Membrane-associated when active and soluble when inactive. Depending on the stage of the cell cycle, detected in the nucleus.
Marker
Exosome Marker
Specificity
TSG101 - tumor susceptibility gene 101
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSG101
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSG101 Antibody (5B7) [DyLight 755]

  • ESCRT-I complex subunit TSG101
  • TSG10
  • tumor susceptibility gene 10
  • tumor susceptibility gene 101 protein
  • tumor susceptibility gene 101
  • tumor susceptibility protein
  • VPS23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-85976
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
H00007251-M01IR
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TSG101 Antibody (H00007251-M01IR) (0)

There are no publications for TSG101 Antibody (H00007251-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSG101 Antibody (H00007251-M01IR) (0)

There are no reviews for TSG101 Antibody (H00007251-M01IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSG101 Antibody (H00007251-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSG101 Products

Bioinformatics Tool for TSG101 Antibody (H00007251-M01IR)

Discover related pathways, diseases and genes to TSG101 Antibody (H00007251-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSG101 Antibody (H00007251-M01IR)

Discover more about diseases related to TSG101 Antibody (H00007251-M01IR).
 

Pathways for TSG101 Antibody (H00007251-M01IR)

View related products by pathway.

PTMs for TSG101 Antibody (H00007251-M01IR)

Learn more about PTMs related to TSG101 Antibody (H00007251-M01IR).
 

Research Areas for TSG101 Antibody (H00007251-M01IR)

Find related products by research area.

Blogs on TSG101.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSG101 Antibody (5B7) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol TSG101