TSC22/TSC22D1 Antibody

Images

 
Western Blot: TSC22/TSC22D1 Antibody [H00008848-D01P] - Analysis of TSC22D1 expression in Hela S3 NE.
Western Blot: TSC22/TSC22D1 Antibody [H00008848-D01P] - Analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 polyclonal antibody.Lane 1: TSC22D1 transfected lysate(15.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSC22/TSC22D1 Antibody Summary

Immunogen
TSC22D1 (NP_006013.1, 1 a.a. - 144 a.a.) full-length human protein. MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Specificity
TSC22D1 - TSC22 domain family, member 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSC22D1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSC22/TSC22D1 Antibody

  • Cerebral protein 2
  • Egr5
  • KIAA1994
  • MGC17597
  • Regulatory protein TSC-22
  • RP11-269C23.2
  • TGFB1I4
  • TGFB-stimulated clone 22 homolog
  • transforming growth factor beta 1 induced transcript 4
  • Transforming growth factor beta-1-induced transcript 4 protein
  • transforming growth factor beta-stimulated protein TSC-22
  • TSC22 domain family 1
  • TSC22 domain family protein 1
  • TSC22 domain family, member 1
  • TSC22
  • TSC22D1
  • TSC22DKFZp686O19206

Background

TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38061
Species: Hu
Applications: IHC, IHC-P
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-80688
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr

Publications for TSC22/TSC22D1 Antibody (H00008848-D01P) (0)

There are no publications for TSC22/TSC22D1 Antibody (H00008848-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSC22/TSC22D1 Antibody (H00008848-D01P) (0)

There are no reviews for TSC22/TSC22D1 Antibody (H00008848-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSC22/TSC22D1 Antibody (H00008848-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSC22/TSC22D1 Products

Bioinformatics Tool for TSC22/TSC22D1 Antibody (H00008848-D01P)

Discover related pathways, diseases and genes to TSC22/TSC22D1 Antibody (H00008848-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSC22/TSC22D1 Antibody (H00008848-D01P)

Discover more about diseases related to TSC22/TSC22D1 Antibody (H00008848-D01P).
 

Pathways for TSC22/TSC22D1 Antibody (H00008848-D01P)

View related products by pathway.

PTMs for TSC22/TSC22D1 Antibody (H00008848-D01P)

Learn more about PTMs related to TSC22/TSC22D1 Antibody (H00008848-D01P).
 

Research Areas for TSC22/TSC22D1 Antibody (H00008848-D01P)

Find related products by research area.

Blogs on TSC22/TSC22D1

There are no specific blogs for TSC22/TSC22D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSC22/TSC22D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSC22D1
Entrez
Uniprot