Tryptophanyl tRNA synthetase Antibody (3A12) [PerCP]

Images

 

Order Details


    • Catalog Number
      H00007453-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Tryptophanyl tRNA synthetase Antibody (3A12) [PerCP] Summary

Immunogen
WARS (NP_004175, 50 a.a. - 149 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA
Specificity
WARS (3A12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tryptophanyl tRNA synthetase Antibody (3A12) [PerCP]

  • EC 6.1.1
  • EC 6.1.1.2
  • GAMMA-2
  • hWRS
  • IFI53
  • IFP53trpRS
  • Interferon-induced protein 53
  • TrpRS
  • tryptophan tRNA ligase 1, cytoplasmic
  • Tryptophan--tRNA ligase
  • tryptophanyl-tRNA synthetase
  • tryptophanyl-tRNA synthetase, cytoplasmic
  • WRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54653
Species: Hu
Applications: WB
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP) (0)

There are no publications for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP) (0)

There are no reviews for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptophanyl tRNA synthetase Products

Bioinformatics Tool for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP)

Discover related pathways, diseases and genes to Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP)

Discover more about diseases related to Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP).
 

Pathways for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP)

View related products by pathway.

PTMs for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP)

Learn more about PTMs related to Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP).
 

Research Areas for Tryptophanyl tRNA synthetase Antibody (H00007453-M02PCP)

Find related products by research area.

Blogs on Tryptophanyl tRNA synthetase

There are no specific blogs for Tryptophanyl tRNA synthetase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptophanyl tRNA synthetase Antibody (3A12) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol WARS