Tryptophan hydroxylase 2 Antibody


Western Blot: Tryptophan hydroxylase 2 Antibody [NBP1-52888] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Tryptophan hydroxylase 2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Tryptophan hydroxylase 2 Antibody Summary

Synthetic peptides corresponding to TPH2 (tryptophan hydroxylase 2) The peptide sequence was selected from the N terminal of TPH2. Peptide sequence REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TPH2 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Tryptophan hydroxylase 2 Antibody

  • ADHD7
  • EC 1.14.16
  • EC
  • FLJ37295
  • MGC138872
  • Neuronal tryptophan hydroxylase
  • NTPH
  • NTPHMGC138871
  • TPH2
  • tryptophan 5-hydroxylase 2
  • Tryptophan 5-monooxygenase 2
  • Tryptophan Hydroxylase 2


Tryptophan hydroxylase (TPH; EC is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, TCS
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P

Publications for Tryptophan hydroxylase 2 Antibody (NBP1-52888) (0)

There are no publications for Tryptophan hydroxylase 2 Antibody (NBP1-52888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan hydroxylase 2 Antibody (NBP1-52888) (0)

There are no reviews for Tryptophan hydroxylase 2 Antibody (NBP1-52888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptophan hydroxylase 2 Antibody (NBP1-52888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Tryptophan hydroxylase 2 Products

Bioinformatics Tool for Tryptophan hydroxylase 2 Antibody (NBP1-52888)

Discover related pathways, diseases and genes to Tryptophan hydroxylase 2 Antibody (NBP1-52888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan hydroxylase 2 Antibody (NBP1-52888)

Discover more about diseases related to Tryptophan hydroxylase 2 Antibody (NBP1-52888).

Pathways for Tryptophan hydroxylase 2 Antibody (NBP1-52888)

View related products by pathway.

PTMs for Tryptophan hydroxylase 2 Antibody (NBP1-52888)

Learn more about PTMs related to Tryptophan hydroxylase 2 Antibody (NBP1-52888).

Research Areas for Tryptophan hydroxylase 2 Antibody (NBP1-52888)

Find related products by research area.

Blogs on Tryptophan hydroxylase 2

There are no specific blogs for Tryptophan hydroxylase 2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tryptophan hydroxylase 2 Antibody and receive a gift card or discount.


Gene Symbol TPH2